RP-HPLC purity raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-08-01. Anything still debated is marked as such rather than presented as settled.
Lyophilized selank is normally supplied as a dry powder and is considered stable for extended periods when kept cold and dry. Moisture uptake is the main practical threat, because absorbed water promotes both hydrolysis and aggregation in the solid state. Vials are usually warmed to room temperature before opening so that condensation does not form on the powder. Supplier documentation commonly specifies -20 °C for routine storage, with -80 °C used for material intended to be archived for years.
Once dissolved, the peptide is markedly less stable than the dry powder. Aqueous solutions are subject to backbone hydrolysis and to microbial growth when they are handled without sterile technique. Buffered solutions near neutral pH are common for short-term laboratory work, while acidic conditions are sometimes used to improve solubility. Analytical laboratories generally prepare working solutions fresh rather than storing them, and a residual water film left in a reopened vial can seed degradation even when the container appears dry.
Reversed-phase high-performance liquid chromatography is the standard technique for estimating peptide purity. The result is a peak-area percentage, which describes how much of the detected material elutes as the main peak in one run. Mass spectrometry confirms the molecular mass and can reveal truncated, adducted, or otherwise modified species. Amino acid analysis or tandem mass spectrometry can address sequence fidelity when identity is in doubt. None of these measurements, taken alone, establishes that a sample is fit for any specific purpose.
Selank is a synthetic heptapeptide developed in Russia. Its sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, a seven-residue chain built around the natural tetrapeptide tuftsin. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences first described the compound in the mid-1990s. The design combined the tuftsin core with an added Pro-Gly-Pro tail, a modification intended to extend the molecule's stability in biological fluids. Published work on the peptide has appeared mainly in Russian-language journals.
Reported activity for Selank centers on anxiolytic and nootropic effects. Russian clinical reports describe use in anxiety and in cognitive or attention-related complaints. Most of this evidence comes from studies conducted by the same research groups that developed the peptide. Independent replication in other countries remains limited, and no major Western regulatory agency has approved the compound for any indication. The gap between local reports and external verification is a recurring point in discussions of the peptide.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95 percent or higher by RP-HPLC | Area percentage of the main peak |
| Identity confirmation | Electrospray ionization mass spectrometry | Observed mass compared with the theoretical value near 751.9 Da |
| Recommended dry storage | -20 °C, desiccated | -80 °C for multi-year archival material |
| Solution handling | Prepare fresh; avoid long storage | Sterile filtration reduces microbial load |
| Common synonyms | TKPRPGP; TP-7 | Sequence code and laboratory designation used interchangeably |
The compound has a calculated molecular weight near 751.9 daltons and carries a net positive charge at physiological pH because of its arginine residue. It dissolves freely in water and in common aqueous buffers, and typically appears as a white or off-white lyophilized powder. The amide backbone makes the molecule susceptible to peptidases, which limits oral use and favors intranasal or parenteral routes. Nomenclature in the literature varies: the substance is also described by the sequence abbreviation TP-7 and by a Russian trade designation.
Regulatory status differs sharply by region. Selank holds a Russian marketing authorization, where it is supplied mainly as nasal drops, while authorities elsewhere have not approved it for medical use. Material sold internationally is therefore usually labeled as a research chemical rather than a medicine. Peer-reviewed publications come predominantly from Russian laboratories, and sample sizes are generally small. Whether the compound produces comparable effects under independent, well-controlled replication remains an open question that the broader literature has not settled.
Published clinical evidence is limited. Most controlled trials were conducted in Russia, enrolled modest numbers of participants, and appeared in Russian-language journals, which restricts independent verification. Reported outcomes include lower anxiety scores, improved attention and memory measures, and changes in fatigue ratings. Reviews written in English note methodological limitations such as small samples and inconsistent endpoints. Whether the compound produces clinically meaningful benefit relative to established anxiolytics is therefore an open question rather than an established finding.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences as a structural analogue of tuftsin, a naturally occurring tetrapeptide fragment of the immunoglobulin heavy chain. The added Pro-Gly-Pro tail was intended to slow enzymatic degradation and extend biological activity. In Russia it is registered as an anxiolytic nasal preparation, while regulators elsewhere have not approved it for clinical use.
Proposed mechanisms centre on modulation of the GABAergic system, with reports of altered expression of genes related to GABA-A receptor subunits and changed monoamine turnover. Some studies describe inhibition of enkephalinase, the enzyme that degrades endogenous enkephalins, which may prolong opioid peptide signalling. Effects on brain-derived neurotrophic factor and on cytokine expression have also been reported. These findings come largely from animal models and small human studies, and the precise primary target remains unresolved.
Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter notation. Its structure consists of the immunomodulatory tetrapeptide tuftsin, Thr-Lys-Pro-Arg, extended at the carboxyl terminus by a Pro-Gly-Pro segment. The molecular formula is commonly given as C33H57N11O9, corresponding to a monoisotopic mass near 751.4 Da and an average molecular mass near 751.9 Da. All seven residues are proteinogenic amino acids, and the molecule carries no modified side chains or non-natural linkages.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
== Reception == Anathem received several positive reviews. Paul Boutin wrote in The Wall Street Journal that "the lasting satisfaction of Anathem derives … from Mr. Stephenson's wry contempt for today's just-Google-it mindset. His prose is dense, but his worldview contagious." On Salon.com, Andrew Leonard described the book as "a page turner and a philosophical argument, an adventure novel and an extended existential meditation, a physics lesson, sermon and ripping good yarn." Michael Dirda of The Washington Post disagreed, remarking that "Anathem will certainly be admired for its intelligence, ambition, control and ingenuity", but describing it as "fundamentally unoriginal", "grandiose, overwrought and pretty damn dull." David Itzkoff of The New York Times concluded that "Anathem spends so much time engaged in copying, in conjuring up alternative formulations of our real-world science and religion, that it forgets to come up with much that is new or true." The novel entered The New York Times Best Seller list for Hardcover Fiction at number one and achieved the rare distinction for a novel of being reviewed in the scientific journal Nature. Anathem won the Locus Award for Best Science Fiction Novel in 2009 and collected nominations for the Hugo, Arthur C. Clarke, and John W. Campbell Memorial Awards the same year. In 2008, the novel received a nomination for the British Science Fiction Award.
== Family sphere == Women in France perform approximately 64% of household labor. Between 1966 and 1986, men's participation in domestic tasks increased slightly but has remained largely unchanged since. Task distribution becomes more unequal in households with two or more children, with men's involvement decreasing by about 10%. A study by INED reports that 30% of men primarily manage household chores; however, this figure does not include the 15% of children involved in family court proceedings following separation, in which fathers may take on increased caregiving and domestic responsibilities. According to a 2010 INSEE study, women spend an average of 3 hours and 26 minutes per day on domestic tasks, compared to 2 hours for men. Child custody is contested in approximately 18% of divorces. In about 90% of cases, custody is awarded to the mother, with few fathers requesting custody. Custody is awarded to fathers in about 8% of cases. Post-divorce, women experience a greater decline in standard of living compared to men. Following separation, approximately one-third of women and one-half of men enter new partnerships. Shared custody arrangements are becoming more common and now account for about 10% of divorce cases.
Sources: en.wikipedia.org
==== Gastronomy ==== In gastronomy, in situ refers to the art of cooking with the different resources that are available at the site of the event. Here a person is not going to the restaurant, but the restaurant comes to the person's home.
== Desalting and Buffer Exchange vs. Dialysis == Dialysis is useful for many of the same desalting and buffer exchange applications performed with gel filtration chromatography, as both methods are based on similar molecular weight cut-off limits. Gel filtration has the advantage of speed (a few minutes vs. hours for dialysis) along with the ability to remove contaminants from relatively small-volume samples compared to dialysis which is an important feature when working with toxic or radioactive substances. Dialysis, on the other hand, is much less dependent on sample size as related to device format. For dialysis applications, achieving a high percentage sample recovery and molecule removal is generally straight forward with little optimization. For gel filtration applications it is important to select a column size and format that is suitable for your sample.
The relationship between the Druze and Christians in Israel has generally been marked by harmony and peaceful coexistence, with both communities living together in peace, harmony, and friendship. However, there have been rare clashes, including instances of violence by the Druze against Christians, such as the incident in 2005 in the town of town of Maghar. Druze and Christians in Israel participate in each other's cultural events, including births, weddings, funerals, and celebrations like the Christian festival of Mar Ilyas (Saint Elias) in Haifa. Additionally, many Druze students are enrolled in Christian schools across the Galilee and Haifa regions. Some Druze towns are situated near significant Christian holy sites, with the most prominent being the Catholic Muhraqa Monastery located 2 kilometres southeast of Daliyat al-Karmel, the largest Druze town in Israel, and marks the contest between prophet Elijah and the priests of Ba'al. It belongs to the Carmelite Order. In the predominantly Druze town of Hurfeish, there is the Church and House of Saint Mariam Baouardy. Interaction between Christians, including members of the Maronite, Eastern Orthodox, Melkite, and other churches, and the Unitarian Druze has resulted in the establishment of mixed villages and towns in Galilee region, Mount Carmel, and the Israeli-occupied portion of the Golan Heights. These include Abu Snan, Daliyat al-Karmel, Ein Qiniyye, Hurfeish, Isfiya, Kafr Yasif, Kisra-Sumei, Majdal Shams, Maghar, Peki'in, Rameh and Shefa-Amr, where more than 82,000 Druze and 30,000 Christians reside together.
In the reproductive system ciliated epithelium in the fallopian tubes move the egg from the uterus to the ovary. Motile cilia also known as flagella, drive the sperm cells. Invertebrate planarians have ciliated excretory flame cells. Other excretory cells also found in planarians are solenocytes that are long and flagellated.
Sources: en.wikipedia.org
Sealed, desiccated storage at -20 °C or colder is the standard recommendation for research-grade material. Vials should reach room temperature before they are opened, which limits condensation. Repeated temperature cycling is discouraged.
A reported purity value reflects the share of the main peak in one chromatographic run and says nothing about identity. Confirming that the expected sequence is present requires a separate measurement such as mass spectrometry. Purity and identity are distinct questions.
A mass spectrum reports the molecular masses present in a sample and shows whether they match the value expected for selank, near 751.9 Da. It also flags common artifacts such as truncation or adduct formation. It does not establish correct stereochemistry or complete sequence order on its own.
Selank is a synthetic peptide made of seven amino acids. It is modeled on tuftsin, a natural tetrapeptide, with an added three-residue tail. It is not a small-molecule drug.