Everything below concerns Semax. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-08-15. Numbers and descriptions here follow the published literature rather than marketing material.
Most published work on selank originates from a small number of research groups in the Russian Federation. A large share of that record appears in Russian-language journals, which limits access for readers who rely on English-indexed databases. Independent replication by laboratories outside the original research network is sparse in publicly available sources. This concentration of origin and language is a frequently noted feature when the compound is summarized in broader reviews of synthetic peptides.
Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, with mass spectrometry used to confirm molecular mass and sequence information. Amino acid analysis and peptide mapping may supplement these methods. Certified reference standards are scarce, and many commercial lots are sold as research chemicals without a pharmacopoeial monograph. Regulatory treatment differs by country: Selank is a registered prescription medicine in Russia, while in the European Union and the United States it is not an approved drug and may fall under research-chemical or unapproved-product frameworks.
Selank is a hydrophilic peptide and dissolves readily in water and in aqueous buffers. The lyophilised powder is typically a white to off-white solid. Because short peptides are prone to hydrolysis and oxidation, handling benefits from limiting exposure to heat, moisture and strong light. Working solutions are commonly prepared in sterile water or saline, and repeated freeze-thaw cycles are avoided to reduce aggregation and loss of activity. These practices reflect general laboratory convention rather than published stability specifications.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C33H57N11O9 | Derived from the seven-residue sequence |
| Molecular weight | About 751.9 g/mol | Average mass; the monoisotopic value is slightly lower |
| Residue count | Seven amino acids | Thr-Lys-Pro-Arg-Pro-Gly-Pro |
| Parent compound | Tuftsin (Thr-Lys-Pro-Arg) | Selank extends tuftsin at the C-terminus |
| Compound class | Synthetic short peptide | Studied in a research setting; not a licensed drug in most markets |
Lyophilized Selank, the dry powder form, is generally stored frozen at minus 20 degrees Celsius or colder for long-term keeping. The solid is hygroscopic and should stay sealed, dry, and protected from light. Once dissolved, the peptide is less stable and is usually held refrigerated at 2 to 8 degrees Celsius for short periods. Repeated freezing and thawing is avoided because it can promote aggregation and loss of activity. Buffers and pH choice also affect how long a solution remains usable.
Solubility behavior is a practical concern for handling. Selank dissolves readily in water and in common aqueous buffers, which simplifies preparation of working solutions. The choice of solvent, ionic strength, and pH can influence aggregation over time, particularly at higher concentrations. Aqueous solutions are typically sterile-filtered before use. Because stability depends on several variables, storage and handling notes should be treated as general guidance rather than fixed rules, and specific values are best confirmed against a certificate of analysis for each batch.
Naming for this compound is not fully standardised in English sources. The spelling Selanc appears in some transliterations, and catalogue entries may instead list the peptide sequence itself as the identifier. Reference material sometimes groups it with other short synthetic peptides studied for behavioural effects, which can create confusion when citations are compared. Distinguishing the exact sequence from related tuftsin analogues is therefore a practical first step when reviewing any dataset or specification sheet.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, frequently abbreviated as TKPRPGP. It was designed as a structural analogue of tuftsin, a naturally occurring tetrapeptide released by enzymatic cleavage of the immunoglobulin heavy chain. The two additional proline residues at the C-terminal end extend the parent chain and change how the molecule behaves in solution. The free peptide has a calculated molecular mass of approximately 751.9 g/mol and is generally supplied as a lyophilised white to off-white powder.
The compound was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences during the 1980s and 1990s. The stated design goal was to retain the immunomodulatory and central nervous system activity attributed to tuftsin while improving resistance to enzymatic breakdown. Adding a proline-rich tail to the short parent peptide was a deliberate strategy, because proline residues restrict the conformations available to many peptidases. The same laboratory produced Semax, an ACTH fragment analog, and both compounds were developed in parallel as short, enzymatically stabilized peptides intended for intranasal use.
Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.
Selank is a synthetic heptapeptide developed in Russia as a structural analogue of tuftsin, a naturally occurring immunomodulatory tetrapeptide. Its sequence, Thr-Lys-Pro-Arg-Pro-Gly-Pro, keeps the tuftsin core at the N-terminus and appends a Pro-Gly-Pro tail. Researchers at the Institute of Molecular Genetics in Moscow synthesized the compound during the 1990s while searching for peptides with combined anxiolytic and immunomodulatory activity. The added tail was intended to resist enzymatic cleavage and prolong the molecule's presence in circulation.
The compound has a calculated molecular weight near 751.9 daltons and carries a net positive charge at physiological pH because of its arginine residue. It dissolves freely in water and in common aqueous buffers, and typically appears as a white or off-white lyophilized powder. The amide backbone makes the molecule susceptible to peptidases, which limits oral use and favors intranasal or parenteral routes. Nomenclature in the literature varies: the substance is also described by the sequence abbreviation TP-7 and by a Russian trade designation.
In 1889, under the Local Government Act 1888, the Cumberland County Council was created as the county council for Cumberland, taking over administrative functions from the Court of Quarter Sessions. The Local Government Act 1894 reconstituted the existing sanitary districts as urban districts and rural districts, each with an elected council. The Local Government Act 1888 also allowed any municipal borough with a population of 50,000 people or more to become a "county borough", independent of county council control. In 1914, Carlisle successfully applied for this status, ceasing to form part of the administrative county, although remaining within Cumberland for the purposes such as lieutenancy and shrievalty.
More recent evidence suggests that estrogen promotes cholestasis via its metabolite estradiol-17-β-D-glucuronide (E2). E2 secreted into the canaliculi by MRP2 was found to repress the transcription of bile salt export pump (BSEP), the apical ABC transporter responsible for exporting monoanionic conjugated bile acids from hepatocytes into bile canaliculi. E2 was also found to upregulate miR-148a, which represses expression of the pregnane X receptor (PXR). PXR is a nuclear receptor in hepatocytes that senses intracellular bile acid concentrations and regulates gene expression accordingly to increase bile efflux. Genetic predisposition for ICP is suggested by familial and regional clustering of cases. Several studies have implicated heterozygous mutations of the genes ABCB11 and ABCB4 in ICP, which respectively encode the canalicular transport proteins BSEP and multidrug resistance protein 3 (MDR3). MDR3 is responsible for exporting phosphatidylcholine, the major lipid component of bile, into bile canaliculi where it forms micelles with bile salts to prevent the latter from damaging luminal epithelium. Bile flow requires canalicular secretion of both bile salts and phosphatidylcholine. MDR3 mutations are an established predisposing factor, found in 16% of ICP cases. More recently, studies have demonstrated involvement of BSEP mutations in at least 5% of cases. The V444A polymorphism of ABCB11 in particular may lead to ICP by causing a reduction in hepatic BSEP expression and consequently decreased bile salt export.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Mahathir visited South Africa three times during his tenure as prime minister: a private visit in April 1994 to congratulate Mandela, an official visit in August 1995, and another in May 1997 when he received the Order of Good Hope. On 27 August 2013, the Mahathir Global Peace Foundation honoured Mandela with the Mahathir Award for Global Peace. In the same year as Mandela's passing, Mahathir expressed his deep sorrow, calling Mandela a great leader who dedicated his life to social justice. He admired Mandela's magnanimity, noting that despite years of imprisonment, he focused on reconciliation and sharing opportunities between blacks and whites. Mahathir also paid his last respects to Mandela in Pretoria, where he attended as a personal representative of Malaysia.
==== Charlotte's Web ==== Charlotte's Web is a high-cannabidiol (CBD), low-tetrahydrocannabinol (THC) cannabis variety and extract marketed as a dietary supplement under federal law of the United States. It is produced by the Stanley brothers in Colorado. It does not induce the psychoactive "high" typically associated with recreational marijuana strains that are high in THC. In September 2014, the Stanleys announced that they would ensure that the product consistently contained less than 0.3% THC. Charlotte's Web gained national attention when it was used to treat Charlotte Figi's epileptic seizures. Her story has led to her being described as "the girl who is changing medical marijuana laws across America," as well as the "most famous example of medicinal hemp use".
Sources: en.wikipedia.org
epistasis The collective action of multiple genes interacting during gene expression. A form of gene action, epistasis can be either additive or multiplicative in its effects on specific phenotypic traits.
== General description == C chondrites contain a relatively high proportion of carbon (up to 3%), which is in the form of graphite, carbonates, and organic compounds, including amino acids. In addition, they contain water and minerals that have been modified by the influence of water. The carbonaceous chondrites were not exposed to higher temperatures, so that they are hardly changed by thermal processes. Some carbonaceous chondrites, such as the Allende meteorite, contain calcium-aluminum-rich inclusions (CAIs). These are compounds that emerged early from the primeval solar nebula, condensed out and represent the oldest minerals formed in the Solar System. Some primitive carbonaceous chondrites, such as the CM chondrite Murchison, contain presolar minerals, including moissanite (natural silicon carbide) and tiny nanometer-sized diamonds that apparently were not formed in the Solar System. These presolar minerals were probably formed during the explosion of a nearby supernova or in the vicinity of a pulsating red giant (more precisely: a so-called AGB star) before they got into the cloud of matter from which the Solar System was formed. Such star explosions release pressure waves that can condense clouds of matter in their surroundings, leading to the formation of new ones, stars and planetary systems. Another carbonaceous chondrite, the Flensburg meteorite (2019), provides evidence of the earliest known occurrence of liquid water in the young Solar System to date.
The electrostatic sector may be before or after the magnetic sector depending on the particular instrument, and reduces the spread in kinetic energy caused by the plasma. This spread is particularly large for ICP-MS, being larger than Glow Discharge and much larger than TIMS. The geometry of the instrument is chosen so that the instrument the combined focal point of the electrostatic and magnetic sectors is at the collector, known as Double Focusing (or Double Focussing). If the mass of interest has a low sensitivity and is just below a much larger peak, the low mass tail from this larger peak can intrude onto the mass of interest. A Retardation Filter might be used to reduce this tail. This sits near the collector, and applies a voltage equal but opposite to the accelerating voltage; any ions that have lost energy while flying around the instrument will be decelerated to rest by the filter.
A neurohormone is any hormone produced and released by neuroendocrine cells (also called neurosecretory cells) into the blood. By definition of being hormones, they are secreted into the circulation for systemic effect, but they can also have a role of neurotransmitter or other roles such as autocrine (self) or paracrine (local) messenger. The hypothalamus releasing hormones are neurohypophysial hormones in specialized hypothalamic neurons which extend to the median eminence and posterior pituitary. The adrenal medulla produces adrenomedullary hormones in chromaffin cells, cells which are very similar in structure to post-synaptic sympathetic neurons, even though they are not neurons they are derivatives of the neural crest. Enterochromaffin and enterochromaffin-like cells, both being enteroendocrine cells, are also considered neuroendocrine cells due to their structural and functional similarity to chromaffin cells, although they are not derivatives of the neural crest. Other neuroendocrine cells are scattered throughout the body. Neurohormone are released by neurosecretory cells
Sources: en.wikipedia.org
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, designed as a metabolically stabilized analogue of the endogenous tetrapeptide tuftsin. It has been studied mainly against anxiety-related and cognitive endpoints rather than as an approved medicine in most jurisdictions.
Tuftsin contains four residues, while selank carries an additional Pro-Gly-Pro segment at the carboxyl end. That extension is intended to reduce enzymatic cleavage. Comparative pharmacokinetic data in humans remain limited.
No single receptor target is widely accepted as the definitive mediator of the reported effects. Proposed contributors include GABAergic modulation, shifts in monoamine turnover, and altered neuropeptide degradation. The mechanism is treated in the literature as unresolved.
Dry powder is normally held at -20 degrees Celsius or below in a sealed, light-protected container with desiccant. Brief room-temperature handling during weighing is generally tolerated. Storage instructions vary between suppliers, so the accompanying certificate of analysis should be followed.