This is a working overview of selank, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-10-22 and is reviewed periodically as new material appears.
Enzymatic stability motivates the extra three residues at the carboxyl end. Native tuftsin is cleaved quickly by circulating aminopeptidases and carboxypeptidases, which limits its duration of action and its usefulness as a tool compound. Extending the chain with proline-rich segments is a common design tactic because proline constrains the backbone and slows proteolysis. The same Pro-Gly-Pro motif appears in other Russian-developed peptides of the era. Whether the full seven-residue chain is required for activity, or whether it acts mainly as a prodrug releasing tuftsin, remains unresolved.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. Its four N-terminal residues reproduce tuftsin, a tetrapeptide fragment of the immunoglobulin heavy chain, while the C-terminal Pro-Gly-Pro extension is a synthetic addition. The peptide has a molecular mass near 752 daltons and carries a net positive charge at physiological pH because of the arginine and lysine side chains. Published indexes list it under the name Selank and the sequence abbreviation TKPRPGP. Solid-phase peptide synthesis is the standard production route for research quantities.
Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic heptapeptide | Tuftsin analogue with a C-terminal Pro-Gly-Pro tail |
| Amino acid sequence | Thr-Lys-Pro-Arg-Pro-Gly-Pro | Abbreviated TKPRPGP in most catalogues |
| Molecular mass | About 752 Da | Value for the free peptide |
| Solubility | Freely soluble in water | Aqueous solutions are kept cold and used promptly |
| Typical storage | -20 °C, dry, protected from light | Applies to the lyophilised powder before reconstitution |
The primary structure of Selank is Thr-Lys-Pro-Arg-Pro-Gly-Pro, corresponding to the molecular formula C33H57N11O9 and a monoisotopic mass of roughly 751.9 daltons. The N-terminal threonine and the arginine residue in the fourth position are shared with tuftsin, which carries the sequence Thr-Lys-Pro-Arg. The three additional residues at the C-terminus, Pro-Gly-Pro, extend the chain and are associated with greater resistance to enzymatic degradation. This extension also separates Selank from the shorter parent peptide.
Naming conventions place Selank in the same research family as Semax, another Russian-developed peptide investigated for cognitive effects. The two compounds share a lineage but differ in sequence and in the biological systems proposed as their targets. Semax descends from ACTH fragments, whereas Selank descends from tuftsin. Publications sometimes identify Selank by its full peptide sequence or by laboratory codes rather than one uniform trade name. Because replication outside Russia is limited, reports on its properties are best read alongside the study design and the purity of the material tested.
Selank is a synthetic heptapeptide developed in Russia during the 1990s. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences designed it as a stabilized analog of tuftsin, a naturally occurring immunomodulatory tetrapeptide. The compound has been studied primarily for its reported anxiolytic and nootropic effects. It remains largely unknown in Western pharmacology and is not approved as a medicine by major regulators such as the FDA or the EMA.
Selank is a synthetic heptapeptide developed in Russia as a structural analogue of tuftsin, a naturally occurring immunomodulatory tetrapeptide. Its sequence, Thr-Lys-Pro-Arg-Pro-Gly-Pro, keeps the tuftsin core at the N-terminus and appends a Pro-Gly-Pro tail. Researchers at the Institute of Molecular Genetics in Moscow synthesized the compound during the 1990s while searching for peptides with combined anxiolytic and immunomodulatory activity. The added tail was intended to resist enzymatic cleavage and prolong the molecule's presence in circulation.
The compound has a calculated molecular weight near 751.9 daltons and carries a net positive charge at physiological pH because of its arginine residue. It dissolves freely in water and in common aqueous buffers, and typically appears as a white or off-white lyophilized powder. The amide backbone makes the molecule susceptible to peptidases, which limits oral use and favors intranasal or parenteral routes. Nomenclature in the literature varies: the substance is also described by the sequence abbreviation TP-7 and by a Russian trade designation.
Purity assessment relies mainly on reverse-phase high-performance liquid chromatography with ultraviolet detection. Because the peptide lacks a strong chromophore, detection often uses backbone absorbance near 214 nm. Identity is confirmed by mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, comparing the measured mass against the expected value. Amino acid analysis can verify composition after acid hydrolysis. Diastereomer content and residual counterions are reported less often, although both can influence biological assays.
Lyophilized material is generally stable for extended periods when kept dry at or below minus twenty degrees Celsius. Working solutions are less stable, and common practice is to aliquot and freeze them so that repeated freeze-thaw cycles are avoided. Aqueous solutions are sensitive to pH extremes and to microbial growth, so short-term storage at refrigerator temperature is typical. Oxidation and hydrolysis are the principal degradation routes. Reconstitution with sterile water or a mild buffer is standard, and solutions should be protected from light.
Regulatory treatment varies by jurisdiction. In Russia the compound is a registered prescription product, while in the European Union and the United States it is generally handled as a research chemical without a marketing authorization. Suppliers therefore operate outside pharmaceutical oversight, and buyers rely on supplier documentation for purity and identity claims. Chain of custody and third-party testing are the main verification tools. Analysts note that the absence of a pharmacopoeial monograph for research-grade material limits standardization across vendors.
Pharmacokinetic data are limited. Like most short peptides, Selank is vulnerable to plasma and tissue peptidases, and its measured half-life in circulation is short, on a minutes scale. The Pro-Gly-Pro tail slows this degradation but does not eliminate it. Intranasal administration is the route described in most reports, with absorption through the nasal mucosa and a hypothesized path into the central nervous system that avoids the blood-brain barrier. Direct measurements of human brain exposure are unavailable, so distribution claims rest on inference from animal work.
Clinical evidence comes mainly from small studies conducted in Russia, several of which were open-label or lacked robust blinding. Reported outcomes include lower anxiety scores, changes in attention measures, and effects on asthenic states following illness. Sample sizes are typically in the tens of participants, and independent replication outside the region is scarce. Reviews published in English generally note the limited methodological quality of the underlying trials. Whether the compound produces clinically meaningful effects under rigorous conditions remains unresolved.
The drugs used in the 2026 Enhanced Games had to be on the US Food and Drug Administration list of legally approved substances, which includes muscle building substances like testosterone and anabolic steroids; substances that boost endurance, like human growth hormone and Erythropoietin (EPO); stimulants, like Adderall, that improve focus; and metabolic drugs, like meldonium, which alter how the body burns fat. Enhanced made drug recommendations, but each athlete was free to choose what they took. According to the Enhanced Games, 91% of the athletes who took performance-enhancing substances used testosterone or testosterone esters; 79% used human growth hormone; 62% used stimulants such as Adderall; 50% used metabolic modulators; 41% used Erythropoietin; and 29% used anabolic steroids. According to strongman Hafþór Júlíus Björnsson, he took testosterone, nandrolone decanoate, oxymetholone and fluoxymesterone. To compete, he said he had to stop taking methandrostenolone, trenbolone and boldenone undecylenate. Cody Miller said he took, in the eight-week period leading up to the competition, testosterone, human growth hormone and oxandrolone.
== Development and release == Counter-Strike: Source is a remake of the original Counter-Strike built on Valve’s Source engine and the third major installment in the Counter-Strike series. Announced on May 12, 2004 during E3 presentation as the multiplayer component of Half-Life 2, it became the first Source engine game released by Valve Software, arriving on Steam for Windows on October 7, 2004, more than a month before Half-Life 2 itself. The first public beta became available on August 11, 2004 through the Valve Cyber Café Program, followed by a wider beta release on August 18 for owners of Counter-Strike: Condition Zero and users who received Half-Life 2 vouchers bundled with select ATI Radeon video cards. The game was later included in Half-Life 2 retail bundles released on November 16, 2004. Development of Counter-Strike: Source began at Valve in January 2004, with contributions from the original Counter-Strike creators Minh Le and Jess Cliffe, as well as members of the Day of Defeat team. The main goal of the developers was to transfer Counter-Strike to the Source engine without altering the core gameplay mechanics. To achieve this, the designers took the Counter-Strike 1.1 build, stripped it down to its bare essentials, and rebuilt it piece by piece in the Source engine. They later incorporated features introduced in subsequent Counter-Strike releases, including version 1.6 and Condition Zero.
== Mechanism == The underlying reason for its occurrence is unclear, though the syndrome appears similar to withdrawal from other psychotropic drugs such as benzodiazepines. For SSRIs, a tapered discontinuation results in less severe symptoms. There is also evidence that antidepressant discontinuation syndrome may be related to the biological half-life of both SSRIs and antidepressants in general. Antidepressants with a lower half-life, such as paroxetine, duloxetine, and venlafaxine, have been implicated in higher incidences of withdrawal symptoms and more severe withdrawal symptoms. The opposite association has been observed in antidepressants with relatively longer half lives, such as fluoxetine. With SSRIs, duration of treatment does not appear associated with the severity of withdrawal symptoms. One hypothesis is that after the antidepressant is discontinued, there is a temporary (but in some cases long-lasting) deficiency in the brain of one or more essential neurotransmitters that regulate mood, such as serotonin, dopamine, norepinephrine, and GABA (gamma-aminobutyric acid), and since neurotransmitters are an interrelated system, dysregulation of one affects the others. There may be a link between lower 5-hydroxytryptamine (5-HT, i.e. serotonin) receptor availability and symptoms of antidepressant discontinuation syndrome. Among antidepressants analyzed by Gastaldon et al. (2022), lofepramine, vortioxetine, mianserin, agomelatine, and esketamine are not associated with significantly disproportionate reporting of withdrawal syndrome.
Unlike folinic acid, it may be used in MTFHR deficiency and MTHFS deficiency: 5-MTHF is the directly usable form of folate in methoinine metabolism, in contrast to folinic acid which needs to be converted to 5-MTHF by these enzymes. Secondary CFD could be treated by non-folate drugs, depending on the precise cause. For example, serine deficiency can be helped by direct supplementation of serine and glycine: this helps with seizure control but does little for psychomotor development. Folic acid (FA), the oxidized form commonly found in diet and ordinary supplements, is not suitable for most forms of CFD and may worsen it. "Transport of folate compounds from the intestine to the brain and competitive inhibition of 5-MTHF transport by FA. Conversion of FA to 5-MTHF is limited in the intestine and is mainly handled by DHFR in the liver, although its enzymatic activity is low in humans. In contrast, folinic acid is efficiently metabolized to 5-MTHF in the intestine and liver. When an excess amount of FA is taken, it cannot be fully reduced by DHFR in the liver and unmetabolized FA appears in the plasma. Because FA has higher affinity to FR1 expressed at the choroid plexus than 5-MTHF, it can act as a competitive inhibitor against 5-MTHF transport from the plasma to the CSF. In addition, FA cannot be metabolized to 5-MTHF efficiently in the brain with extremely low DHFR activity. Thus, excess FA intake may lead to a less effective supply of 5-MTHF to the brain compared with that of folinic acid supplementation."
==== Meningioma ==== Meningiomas are the most common type of primary brain tumors to occur in adults. They are thought to arise from meningothelial arachnoid cells in the meninges. Most commonly they attach firmly to the inner surface of the dura and are well-circumscribed; but some tumors may show brain invasion. More rarely, leptomeningeal cancers may metastasize from tumors elsewhere in the body to the cerebrospinal fluid and leptomeninges.
Sources: en.wikipedia.org
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Corticotropin-releasing hormone (CRH) (also known as corticotropin-releasing factor (CRF) or corticoliberin; corticotropin may also be spelled corticotrophin) is a peptide hormone involved in stress responses. It is a releasing hormone that belongs to corticotropin-releasing factor family. In humans, it is encoded by the CRH gene. Its main function is the stimulation of the pituitary synthesis of adrenocorticotropic hormone (ACTH), as part of the hypothalamic–pituitary–adrenal axis (HPA axis). Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 196-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Increased CRH production has been observed to be associated with Alzheimer's disease and major depression, and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia. In addition to the hypothalamus, CRH is produced by neurons in other brain regions, including the neocortex, limbic system and brainstem. In the olivocerebellar tract, CRH is expressed in neurons that send their axons from the inferior olivary complex to the cerebellar cortex. CRH is also synthesized in peripheral tissues, such as T lymphocytes, and it is highly expressed in the placenta, where it regulates the length of gestation and the timing of parturition and delivery.
=== Pricing and Profits === Throughout B.P.C. control, significant profits were made. In 1948, revenues from the island's phosphate reached $745,000. As the B.P.C. was controlled by its partner governments and was a major supplier of phosphate, it had an effective monopoly over the supply of phosphate to the markets in Australia and New Zealand, and could determine the price of phosphate delivered to those markets. The B.P.C. tied the pice for Ocean Island phosphate to the price paid for Nauru phosphate, however, the BPC would vary the price paid for phosphate. For example, around 1970, Nauru phosphate was sold to Japan at $14 and $15 a ton, but sold into the markets in Australia and New Zealand at $12.30.
A subsequent large randomized controlled trial (RCT), the "ALternatives To prophylactic Antibiotics for the treatment of Recurrent urinary tract infection in women" (ALTAR) trial, was conducted by the United Kingdom National Health Service (NHS). This study, published in 2022, reported that methenamine (hippurate) was non-inferior to daily low-dose antibiotics for prevention of UTIs. The antibiotics used in the study included nitrofurantoin, trimethoprim, and cephalexin. There was a small and non-significant numerical advantage of antibiotics over methenamine in this trial (~0.5 fewer UTIs per year), but this difference was deemed of limited clinical consequence and was considered to be outweighed by the advantages of methenamine. UTI-free rates over 12 months were 43% with methenamine and 54% with antibiotics. Besides effectiveness in terms of UTI prevention, methenamine demonstrated lower rates of bacterial resistance relative to antibiotic therapy in this trial and in other studies. A 2024 systematic review found that methenamine was non-inferior to antibiotic prophylaxis in the prevention of UTIs in two comparative prospective clinical studies, including the ALTAR trial. Other, older studies found that methenamine was inferior to antibiotics including trimethoprim/sulfamethoxazole, trimethoprim, and nitrofurantoin in preventing or suppressing current UTIs, but these studies were of lower quality. Additional large and high-quality clinical trials of methenamine for UTI prevention are needed as of 2024.
Sources: en.wikipedia.org
In analysis of biological systems, inorganic salts, which are also part of protein extracts, interfere with the ionization process. The salts can be removed by solid phase extraction or by washing the dried-droplet MALDI spots with cold water. Both methods can also remove other substances from the sample. The matrix-protein mixture is not homogeneous because the polarity difference leads to a separation of the two substances during co-crystallization. The spot diameter of the target is much larger than that of the laser, which makes it necessary to make many laser shots at different places of the target, to get the statistical average of the substance concentration within the target spot.
=== Social programs === In July 2021, Moore said he opposed Governor Larry Hogan's decision to end expanded federal unemployment benefits provided by the American Rescue Plan Act of 2021 early. In December 2022, Moore said he supported indexing the state's maximum unemployment insurance payment to inflation. In August 2022, Moore supported protests led by veterans at the United States Capitol to pass the Honoring our PACT Act of 2022, which would provide benefits for veterans exposed to burn pits and other toxic phenomena. During his gubernatorial campaign, Moore said he supported establishing a state "baby bonds" program, which would cost roughly $100 million per year and be seeded with $3,200 for every child born on Medicaid, to target the racial wealth gap. If enacted, it would be the largest baby bond program ever enacted in the United States. In September 2022, he told the Maryland Family Network that he would support child care programs by subsidizing the service through tax credits for low-income families. Moore has not advocated for establishing a statewide baby bonds program since becoming governor, but has supported other measures toward expanding childcare access in the state such as an expansion of Maryland's child tax credit. During the 2024 legislative session, Moore introduced the ENOUGH Act, a bill to provide $15 million in grants toward underserved communities. The bill passed and was signed into law in May 2024.
The Mediterranean Institute for Transplantation and Advanced Specialized Therapies (Istituto Mediterraneo per i Trapianti e Terapie ad Alta Specializzazione, or ISMETT) is located in Palermo, Italy, and serves the region of Sicily and the Mediterranean as a hospital designed exclusively for transplants and treatment of end-stage organ failure. ISMETT is a joint public-private partnership between the Region of Sicily, through Civico and Cervello hospitals in Palermo, and UPMC, which manages and operates the facility. It is also a center for research in regenerative medicine and various international collaborations including the University of Pittsburgh's and UPMC's McGowan Institute for Regenerative Medicine.
Sources: en.wikipedia.org
Selank is a seven-amino-acid peptide built from the tuftsin sequence plus a Pro-Gly-Pro tail. It is produced by chemical synthesis rather than extracted from a natural source. The free peptide is usually supplied as a lyophilised powder or in an aqueous formulation.
Tuftsin is a natural tetrapeptide derived from the Fc portion of immunoglobulin G. Selank retains that tetrapeptide at its N-terminus and adds three residues to improve resistance to enzymatic breakdown. The relationship is structural, and the two molecules are not interchangeable in experimental work.
It holds a product registration in Russia for intranasal use as an anxiolytic. Registrations of that kind are not automatically accepted by regulators elsewhere. In most other countries it is treated as an unapproved substance or a research material.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, designed as a metabolically stabilized analogue of the endogenous tetrapeptide tuftsin. It has been studied mainly against anxiety-related and cognitive endpoints rather than as an approved medicine in most jurisdictions.