A practical reference on peptidase: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-04-06. Anything still debated is marked as such rather than presented as settled.
Pharmacokinetic data are limited. Like most short peptides, Selank is vulnerable to plasma and tissue peptidases, and its measured half-life in circulation is short, on a minutes scale. The Pro-Gly-Pro tail slows this degradation but does not eliminate it. Intranasal administration is the route described in most reports, with absorption through the nasal mucosa and a hypothesized path into the central nervous system that avoids the blood-brain barrier. Direct measurements of human brain exposure are unavailable, so distribution claims rest on inference from animal work.
Clinical evidence comes mainly from small studies conducted in Russia, several of which were open-label or lacked robust blinding. Reported outcomes include lower anxiety scores, changes in attention measures, and effects on asthenic states following illness. Sample sizes are typically in the tens of participants, and independent replication outside the region is scarce. Reviews published in English generally note the limited methodological quality of the underlying trials. Whether the compound produces clinically meaningful effects under rigorous conditions remains unresolved.
Solubility behavior is a practical concern for handling. Selank dissolves readily in water and in common aqueous buffers, which simplifies preparation of working solutions. The choice of solvent, ionic strength, and pH can influence aggregation over time, particularly at higher concentrations. Aqueous solutions are typically sterile-filtered before use. Because stability depends on several variables, storage and handling notes should be treated as general guidance rather than fixed rules, and specific values are best confirmed against a certificate of analysis for each batch.
Characterization of Selank in a laboratory setting relies on standard peptide methods. Reverse-phase high-performance liquid chromatography separates the target from related impurities and provides a purity figure, commonly reported as 95 percent or higher. Mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, confirms the molecular mass and helps detect truncation or modification. Amino acid analysis can verify composition when a sequence-level check is needed. These techniques together establish identity and purity for a given lot.
Lyophilized Selank, the dry powder form, is generally stored frozen at minus 20 degrees Celsius or colder for long-term keeping. The solid is hygroscopic and should stay sealed, dry, and protected from light. Once dissolved, the peptide is less stable and is usually held refrigerated at 2 to 8 degrees Celsius for short periods. Repeated freezing and thawing is avoided because it can promote aggregation and loss of activity. Buffers and pH choice also affect how long a solution remains usable.
| Property | Value | Notes |
|---|---|---|
| Route studied | Intranasal | Predominant route in published reports |
| Circulation stability | Short, minutes scale | Peptidases cleave it; the tail slows the process |
| Analytical method | RP-HPLC with mass spectrometry | Used for identity and purity assessment |
| Reported outcome domains | Anxiety and cognitive measures | Derived from small, mostly regional trials |
| Regulatory status | Marketed in Russia | Availability outside that market is limited |
Published clinical work is concentrated in Russian-language journals and generally involves small samples without independent replication. Systematic reviews in English note the shortage of randomised, placebo-controlled trials and the difficulty of verifying methods from translated reports. Outcome measures vary between studies, which complicates pooling of results. Interest in the compound as a cognitive or anxiolytic agent therefore rests on a thinner evidence base than the volume of citations suggests. Replication in well-powered trials with preregistered endpoints would be needed before firm conclusions about efficacy can be drawn.
Proposed mechanisms centre on the GABAergic system. Animal and tissue studies report changes in GABA-A receptor expression and reduced activity of GABA transaminase, the enzyme that degrades GABA. Effects on monoamine turnover, including serotonin and dopamine pathways, are also described, and a separate line of work links the peptide to increased expression of brain-derived neurotrophic factor in hippocampal tissue. Most of these findings come from rodent models and cell preparations. How the individual observations combine into a single coherent mode of action is not settled.
Regulatory status differs sharply by region. Selank holds a Russian marketing authorization, where it is supplied mainly as nasal drops, while authorities elsewhere have not approved it for medical use. Material sold internationally is therefore usually labeled as a research chemical rather than a medicine. Peer-reviewed publications come predominantly from Russian laboratories, and sample sizes are generally small. Whether the compound produces comparable effects under independent, well-controlled replication remains an open question that the broader literature has not settled.
Selank is a synthetic heptapeptide developed in Russia as a structural analogue of tuftsin, a naturally occurring immunomodulatory tetrapeptide. Its sequence, Thr-Lys-Pro-Arg-Pro-Gly-Pro, keeps the tuftsin core at the N-terminus and appends a Pro-Gly-Pro tail. Researchers at the Institute of Molecular Genetics in Moscow synthesized the compound during the 1990s while searching for peptides with combined anxiolytic and immunomodulatory activity. The added tail was intended to resist enzymatic cleavage and prolong the molecule's presence in circulation.
The compound has a calculated molecular weight near 751.9 daltons and carries a net positive charge at physiological pH because of its arginine residue. It dissolves freely in water and in common aqueous buffers, and typically appears as a white or off-white lyophilized powder. The amide backbone makes the molecule susceptible to peptidases, which limits oral use and favors intranasal or parenteral routes. Nomenclature in the literature varies: the substance is also described by the sequence abbreviation TP-7 and by a Russian trade designation.
Dr. Stone is an anime television series produced by TMS Entertainment based on the manga series of the same name written by Riichiro Inagaki and illustrated by Boichi. Set 3,700 years after a mysterious light turns every human on the planet into stone, genius boy Senku Ishigami emerges from his petrification into a "Stone World" and seeks to rebuild human civilization from the ground up. Dr. Stone's second season, titled Dr. Stone: Stone Wars, aired from January 14 to March 25, 2021. The season premiered on Tokyo MX and KBS in a dual simulcast, with other networks following at later timeslots. It focuses on the story of the "Stone Wars" arc from the manga, in which Senku and the Ishigami villagers of the Kingdom of Science go to war with Tsukusa's Kingdom of Strength. The season is streamed by Crunchyroll worldwide outside of Asia, while then-separate company Funimation produced a simuldub. The season ran for 11 episodes. A sequel was announced after second season finale. The English dub for Stone Wars aired on Adult Swim's Toonami programming block from May 16 to July 25, 2021. The opening theme song is "Rakuen" (楽園; lit. 'Paradise') performed by Fujifabric, while the ending theme song is "Koe?" (声?; lit. 'Voice?') performed by Hatena.
== Clinical implications == Disposition index is used as a measure of beta cell function and the ability of the body to dispose of a glucose load. Thus a lowering of disposition index predicts the conversion of insulin resistance to diabetes mellitus type 2. Disposition index, but not insulin resistance, can predict type 2 diabetes in persons with normal blood glucose levels, but who do not have a family history (genetic predisposition) to type 2 diabetes. Disposition index can be increased by aerobic exercise, but only to the extent that insulin sensitivity is improved. The static disposition index (SPINA-DI) declines with increasing adherence to mediterranean diet. This may result from increased use of other macronutrients for the provision of energy and a reduction in the chronic stimulus for dynamical compensation with consecutive insulin hypersecretion. The disposition index is reduced in several chronic conditions including cystic fibrosis, reduced PCSK9 expression and inflammatory diseases, e.g. hidradenitis suppurativa (acne inversa).
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
== Human homologue == Agouti signaling protein (ASP) is the human homologue of murine agouti. It is encoded by the human agouti gene on chromosome 20 and is a protein consisting of 132 amino acids. It is expressed much more broadly than murine agouti and is found in adipose tissue, pancreas, testes, and ovaries, whereas murine agouti is solely expressed in melanocytes. ASP has 85% similarity to the murine form of agouti. As ectopic expression of murine agouti leads to the development of the yellow obese syndrome, this is expected to be consistent in humans. The yellow obese syndrome increases the development of many chronic diseases, including obesity, type II diabetes mellitus and tumorigenesis. ASP has similar pharmacological activation to murine agouti, as melanocortin receptors are inhibited through competitive antagonism. Inhibition of melanocortin by ASP can also be through non-competitive methods, broadening its range of effects. The function of ASP differs to murine agouti. ASP effects the quality of hair pigmentation whereas murine agouti controls the distribution of pigments that determine coat color. ASP has neuroendocrine functions consistent with murine agouti, as it agonizes via AgRP neurons in the hypothalamus and antagonizes MSH at MC4Rs which reduce satiety signals. AgRP acts as an appetite stimulator and increases appetite while decreasing metabolism. Because of these mechanisms, AgRP may be linked to increased body mass and obesity in both humans and mice.
Music hall historian Harold Scott wrote that: "..he sang at his piano perched upon a music stool always on the point of collapse, made jokes, gave satirical opinions upon the events of the day and commented unsparingly upon his own prodigious girth; the whole in the breathless manner and rather asthmatical voice, the management of which was the secret of his style." He made several recordings for Odeon Records, including "Limerickitis", and "Suffragettes' Anthem" (not to be confused with "The March of the Women"), in 1910, in which he was "careful to navigate that narrow line between being offensive and being uncontroversial." On the record, he introduces the song by saying that "the remarks [in the song] do not apply to those earnest ladies who are really earnest in their works, but rather the mountebank militants whose extraordinary antics seem to be alienating the sympathies of most right minded people, I refer to the Suffragettes...". The song itself is a parody of Gilbert and Sullivan's "Three Little Maids Are We" and Vesta Victoria's hit "Waiting at the Church": "There was I waiting in the cold, waiting in the cold, chained up in the cold...". In July 1912, Gammon was considered sufficiently respectable to be the opening act (other than a pair of acrobats, Pipifax and Panlo) at the first ever Royal Command Performance for music hall artists, held at the Palace Theatre in front of King George V, Queen Mary and Edward, Prince of Wales. He was a Freemason.
Sources: en.wikipedia.org
==== Liquid phase exfoliation ==== Liquid phase exfoliation (LPE) is a relatively simple method that involves dispersing graphite in a liquid medium to produce graphene by sonication or high shear mixing, followed by centrifugation. Restacking is an issue with this technique unless solvents with appropriate surface energy are used (e.g. NMP). Adding a surfactant to a solvent prior to sonication prevents restacking by adsorbing to the graphene's surface. This produces a higher graphene concentration, but removing the surfactant requires chemical treatments. LPE results in nanosheets with a broad size distribution and thicknesses roughly in the range of 1-10 monolayers. However, liquid cascade centrifugation can be used to size-select the suspensions and achieve monolayer enrichment. Sonicating graphite at the interface of two immiscible liquids, most notably heptane and water, produced macro-scale graphene films. The graphene sheets are adsorbed to the high-energy interface between the materials and are kept from restacking. The sheets are up to about 95% transparent and conductive. With definite cleavage parameters, the box-shaped graphene (BSG) nanostructure can be prepared on graphite crystal. A major advantage of LPE is that it can be used to exfoliate many inorganic 2D materials beyond graphene, e.g. BN, MoS2, WS2.
Within Betulaceae, birches are most closely related to alder. The oldest known birch fossils are those of Betula leopoldae from the Klondike Mountain Formation in the state of Washington, US, which date to the early Eocene (Ypresian) around 49 million years ago.
In chemistry, particularly in biochemistry, a fatty acid is a carboxylic acid with an aliphatic chain, which is either saturated or unsaturated. Most naturally occurring fatty acids have an unbranched chain of an even number of carbon atoms, from 4 to 28. Fatty acids are a major component of the lipids (up to 70% by weight) in some species such as microalgae but in some other organisms are not found in their standalone form, but instead exist as three main classes of esters: triglycerides, phospholipids, and cholesteryl esters. In any of these forms, fatty acids are both important dietary sources of fuel for animals and important structural components for cells.
Another reason for the gender gap is the fact that young women are better educated and earning more than men in the contemporary American economy. In all, American women below the age of 30 have been moving leftward on a number of key political issues while young men have not moved as much. There is little to no gap in terms of educational attainment or race. Meanwhile, a majority of Gen Z men are engaging with contents from "masculinity influencers" on the Internet, who promote traditional gender roles in which men make the decisions and women comply.
which is conservative, non-traumatic and less invasive and can be performed on an outpatient basis under local anaesthetic in a doctor's office and has the advantage of healing very quickly with little or no significant cosmetic alteration to the appearance of the penis.
Sources: en.wikipedia.org
Reports describe effects on GABA-A receptor expression, monoamine turnover, and neurotrophic factor levels. These are proposed mechanisms drawn mainly from animal models. No single molecular target has been established.
Intranasal delivery is the route described in most published work. It is used because the peptide is degraded quickly once it reaches circulation. Direct evidence of brain penetration in humans is lacking.
Most trials are small, regionally concentrated, and often lack rigorous blinding or placebo control. Independent replication is limited. Reviews in English generally rate the evidence as preliminary.
Reverse-phase HPLC is the usual method and gives a percentage purity value. Mass spectrometry then confirms the molecular mass. Together they provide a basic identity and purity profile for a lot.